PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.6467s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 343aa    MW: 37487.4 Da    PI: 5.0501
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.6467s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.11.2e-18254288135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  Cagra.6467s0001.1.p 254 CSHCGVQKTPQWRAGPMGAKTLCNACGVRYKSGRL 288
                          *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.6E-1021342IPR016679Transcription factor, GATA, plant
SMARTSM004016.3E-16248302IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.793248284IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-14251311No hitNo description
Gene3DG3DSA:3.30.50.104.7E-15252286IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.34E-14253301No hitNo description
PROSITE patternPS003440254279IPR000679Zinc finger, GATA-type
PfamPF003201.4E-16254288IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MEQAALKSSI RKEMAFKSTL PVYEDYLSVT TAQNGFSPDD FSVDDLLDLS NDDVFADDDT  60
DLKPQDPVMV RVSSEEEEEE EEEELNDDGD ALPRCIDFSG SLPTSELSVP ADDLANLEWL  120
SHFVEDSFTE YSGPNLTGTP TEKPAWLTGD RKHPVTPATQ ESCFKSPVPA KARSKRHRNG  180
VKAWSLGSSS SSGPSSSGST SSSSSSSGPS SPWFSGADLF EPMVASERPP FPKKHKKRSA  240
ESAFCGQLQP QRRCSHCGVQ KTPQWRAGPM GAKTLCNACG VRYKSGRLLP EYRPACSPTF  300
SSELHSNHHR KVMEMRRKKE PTSDSETGLN QLVQSPQAVP SF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1364500.0AY136450.1 Arabidopsis thaliana GATA-binding transcription factor-like protein (At5g66320) mRNA, complete cds.
GenBankBT0103670.0BT010367.1 Arabidopsis thaliana At5g66320 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280758.10.0hypothetical protein CARUB_v10026725mg
RefseqXP_006280759.10.0hypothetical protein CARUB_v10026725mg
SwissprotQ9FH570.0GATA5_ARATH; GATA transcription factor 5
TrEMBLR0EWR40.0R0EWR4_9BRAS; Uncharacterized protein
STRINGAT5G66320.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36982561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-168GATA transcription factor 5